Thank you to whoever can help =)
The following problems involve using the Basic Local Alignment Search Tool or BLAST.
Using NCBIâs BLAST search page answer the following: http://blast.ncbi.nlm.nih.gov/Blast.cgi
Remember: 1) Choose the non-redundant or ânrâ database to access non-human, non-mouse genome data.
2) E value: a negative value or zero is the best value
3) Some proteins have a putative conserved domain which can be accessed by a protein blast.
Using this protein (amino acid) sequence answer the following questions:
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNI SETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSV KVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAE LNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASL LAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEF FGTMKPFILKPKGDDSVTQLILPIRTY
2.1 What is generally the starting amino acid of a protein?
2.2 Perform a protein blast or BLASTp search of the protein. What was your top hit? Also record the E-value.
2.3 What are the conserved domains, if any, from BLASTp?
2.4 Perform a TBLASTn search. What is the best match now? And record the E-value.
2.5 What was the difference in the two results (BLASTp to TBLASTn)?
Thank you to whoever can help =)
The following problems involve using the Basic Local Alignment Search Tool or BLAST.
Using NCBIâs BLAST search page answer the following: http://blast.ncbi.nlm.nih.gov/Blast.cgi
Remember: 1) Choose the non-redundant or ânrâ database to access non-human, non-mouse genome data.
2) E value: a negative value or zero is the best value
3) Some proteins have a putative conserved domain which can be accessed by a protein blast.
Using this protein (amino acid) sequence answer the following questions:
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNI SETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSV KVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAE LNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASL LAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEF FGTMKPFILKPKGDDSVTQLILPIRTY
2.1 What is generally the starting amino acid of a protein?
2.2 Perform a protein blast or BLASTp search of the protein. What was your top hit? Also record the E-value.
2.3 What are the conserved domains, if any, from BLASTp?
2.4 Perform a TBLASTn search. What is the best match now? And record the E-value.
2.5 What was the difference in the two results (BLASTp to TBLASTn)?
